Protein Sequence for fig|93062.19.peg.2265 from Staphylococcus aureus subsp. aureus COL

>fig|93062.19.peg.2265 Hypothetical protein SAV2327
MALIVSRAILFLILALAFGIATVFPEQKLPLYIVFTLFVAVAIVSNVWFTHQNVKKHIIK
FNKYVAYFLSFVSGLLYIGFVIYTLTIGSYDVLPIIIFAISIVLVQILENILGISIKNTR
LSNKQLKVISKQRVQQFKVISLILVSVSIVFIFIALMLKWWLLLVISIIVLIIITVAMIV
YEKYYTTPD