Protein Sequence for fig|93062.19.peg.2133 from Staphylococcus aureus subsp. aureus COL

>fig|93062.19.peg.2133 NAD-dependent protein deacetylase of SIR2 family
MKHDLETLKHIIDSSNRITFFTGAGVSVASGVPDFRSMGGLFDEISKDGLSPEYLLSRDY
LEDDPEGFINFCHKRLLFVDTMPNIVHDWIAKLERNQQSLGIITQNIDGLHSDAGSQHVD
ELHGTLNRFYCNVCHKSYTKSDVIDRTLKHCDNCGGAIRPDIVLYGEMLDQPTIIRALNK
IEHADTLVVLGSSLVVQPAAGLISHFKGDNLIIINKDRTPYDSDATLVIHDDMVSVVKSL
MTE