Protein Sequence for fig|93062.19.peg.1580 from Staphylococcus aureus subsp. aureus COL

>fig|93062.19.peg.1580 Cytidine deaminase (EC 3.5.4.5)
MSYQPHYFQEVRKAQQESYSPYSQFKVGAYLKTKDGRTFYGTNVENASYPLSICAERASL
VSAISQGYRPGDFESITVTVDADKPSSPCGACRQVLKELCDDDMPVYMTNHKGDMVMMTV
AELLPFGFSGKDLE