Protein Sequence for fig|93062.19.peg.1448 from Staphylococcus aureus subsp. aureus COL

>fig|93062.19.peg.1448 23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
MFQLLAVCPMGLEAVVAREIQELGYETNVENGRIFFEGDASAIVKANLWLRTADRIKIVV
GRFNATTFDELFEQTKALPWESIIDKEGNFPVQGRSVKSTLHSVPDCQAITKKAIVERLR
RAYNEKGWLNESGAKYPVEVAILKDNVLLTIDTSGSGLNRRGYRLAQGEAPIKETLAASL
IRLANWKGDTPLIDPFCGSGTIAIEACLIAQNIAPGFNREFVSEQWNIMPANIYDDYRDE
ADKMADYDKEIEVYASDIDPEMVEIAKRNAEEVGLSDIIKFSVKDVNTLTIDTEEPVALI
GNPPYGERIGDREEVEEMYRYIGKLMKQHPFLSTYILTSNKEFEYLVDRKATKRRKLFNG
YIECTYYQYWGKKTERKTIEN