Protein Sequence for fig|93062.19.peg.1325 from Staphylococcus aureus subsp. aureus COL

>fig|93062.19.peg.1325 Hydrolase (HAD superfamily)
MTNYKVVVLDMDDTLLNSDNVISEETANYLTAIQDEGYYVVLASGRPTEGMIPTARDLKL
PEHHSYIISYNGSKTINMTNEEVEVSKSIGKQDFDEIVDYCRDRGFFVLTYHDGQIIYDS
EHEYMNIEAELTGLPMKRVDDIKAYIQGDVPKVMGVDYVANITEARIDLNGVFNDNVDAT
TSKPFFLEFMAKDVSKGNAIKALCHKLGYSVDQVIAFGDSMNDKSMFEVAGLAIAMGNAS
DELKQYANEVTLDHNENGIPHALKKLL