Protein Sequence for fig|93062.19.peg.1028 from Staphylococcus aureus subsp. aureus COL

>fig|93062.19.peg.1028 Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA
MKGKFLKVSSLFVATLTTATLVSSPAANALSSKAMDNHPQQTQSSKQQTPKIQKGGNLKP
LEQREHANVILPNNDRHQITDTTNGHYAPVTYIQVEAPTGTFIASGVVVGKDTLLTNKHV
VDATHGDPHALKAFPSAINQDNYPNGGFTAEQITKYSGEGDLAIVKFSPNEQNKHIGEVV
KPATMSNNAETQVNQNITVTGYPGDKPVATMWESKGKITYLKGEAMQYDLSTTGGNSGSP
VFNEKNEVIGIHWGGVPNEFNGAVFINENVRNFLKQNIEDIHFANDDQPNNPDNPDNPNN
PDNPNNPDEPNNPDNPNNPDNPDNGDTNNSDNPDAA