Protein Sequence for fig|93061.5.peg.2565 from Staphylococcus aureus subsp. aureus NCTC 8325

>fig|93061.5.peg.2565 Phosphinothricin N-acetyltransferase (EC 2.3.1.-)
MIRYAKKEDLNAILAIYNDAIINTTAVYTYEPQTIDERVAWFETKQRKHEPIFVFEENGS
VLGFATFGSFRPWPAYLYTIEHSIYVDASARGKGIASQLLHHLIVEAKAKGYRALVAGID
ASNKASIQLHQKFAFKHAGTLTNVGFKFNRWLDLAFYELDLQD