Protein Sequence for fig|93061.5.peg.2193 from Staphylococcus aureus subsp. aureus NCTC 8325

>fig|93061.5.peg.2193 Ferric-staphyloferrin A ABC transporter, substrate-binding protein
MRGLKTFSILGLIVALLLVAACGNTDNSSKKESSTKDTISVKDENGTVKVPKDAKRIVVL
EYSFADALAALDVKPVGIADDGKKKRIIKPVREKIGDYTSVGTRKQPNLEEISKLKPDLI
IADSSRHKGINKELNKIAPTLSLKSFDGDYKQNINSFKTIAKALNKEKEGEKRLAEHDKL
INKYKDEIKFDRNQKVLPAVVAKAGLLAHPNYSYVGQFLNELGFKNALSDDVTKGLSKYL
KGPYLQLDTEHLADLNPERMIIMTDHAKKDSAEFKKLQEDATWKKLNAVKNNRVDIVDRD
VWARSRGLISSEEMAKELVELSKKEQK