Protein Sequence for fig|93061.5.peg.2042 from Staphylococcus aureus subsp. aureus NCTC 8325

>fig|93061.5.peg.2042 FIG01108895: hypothetical protein
MGNKQCISLNLLLSDDTFAVISVMTTLGTAILGGIAPSIYGIFTSPIDKKSSFRAISDWE
QEQRNNVKDLMMLLPFTLLSILIVIFIFQFAYSKLFNTIAIIIFIIILVVMFFLILLICY
KITVKICRYFSKE