Protein Sequence for fig|93061.5.peg.1887 from Staphylococcus aureus subsp. aureus NCTC 8325

>fig|93061.5.peg.1887 Phage phi 11 orf8 protein homolog
MTPEQKEKLNNIVLTLYAVKENKSQTYTHKDTLTVTYAGEIEHTYEVDREKHLESMIEWA
IDQIEQHFDLDEEE