Protein Sequence for fig|93061.5.peg.1834 from Staphylococcus aureus subsp. aureus NCTC 8325

>fig|93061.5.peg.1834 Phage phi 11 orf51 protein homolog
MEGNFKNVKKFIYEGEEYTKVYAGNIQVWKKPSSFVIKPLPKNKYPDSIEESTAKWTING
VEPNKSYQVTIENVRSGIMRISQTNLGSSDLGISGVNSGVASKNINFSNPSGMLYVTISD
VYSGSPTLTIE