Protein Sequence for fig|93061.5.peg.1813 from Staphylococcus aureus subsp. aureus NCTC 8325

>fig|93061.5.peg.1813 Mobile element protein
MCNDTLELLRIKDENIKYINQEIDVIIKGKKATVVNAVLTYKPSACYCCGVKNEGQIHKH
GKRVSRITLLKTQGYNTYLNLAKQRFKCLECNGTFTAKTSIVDESCFISRCVTQKVIEEA
TKVKTEIDTAEDNCISPSTVSRIRTKAANSLRIKPFNCLPEHIAMDEFKSVKNVTGSMSF
IFIDNDTHDVIDILENRTTRFLRAYFERFDLKNRQQVKTVTIDMYEPYVRLFRDLFPNAA
IIFDRFHIVQHLNRELNKYRVQVMNEYRNKKGPDYTIFKNNWKVLLMDTSKTIFSKYRWN
KSFKAYKRSSDIVEFMLSKDDILRHSYELVQGLRKDLRLCNWPKFINRLNSVSKKSVSKG
VWKVVKYYRKHQRMLRNTIYYPAFNNGAIEGINNKIKLIK