Protein Sequence for fig|93061.5.peg.1669 from Staphylococcus aureus subsp. aureus NCTC 8325

>fig|93061.5.peg.1669 Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46)
MTLNKLKDELQIVSHRGLPSDFPENTMVGYREVMGLNVAMLEIDVHLTKDQHFVVIHDET
IDRTSDGKGRIADYTLSQLKSFDFGSYKDVAFKGERIPTLDEVLSLCLKYDKKLLIELKS
PNLYPEIECKLLAFLEEKKVDATQVVIQSFDIECIEKLNTLGSIYELGVLCSKRNYWYKK
PNFSRIAQIASYVNPNYALVTRKFVDKAHHHQLQVMPYTVNKLKTGEKLRQMGVDGLITD
NPKLFIK