Protein Sequence for fig|93061.5.peg.1667 from Staphylococcus aureus subsp. aureus NCTC 8325

>fig|93061.5.peg.1667 Free methionine-(R)-sulfoxide reductase, contains GAF domain
MTTINPTNYTLLKKQAASLIEDEHHMIAILSNMSALLNDNLDQINWVGFYLLEQNELILG
PFQGHPACVHIPIGKGVCGTAVSERRTQIVADVHQFEGHIACDANSKSEIVVPIFKDDKI
IGVLDIDAPITDRFDDNDKEHLEAIVKIIEKQLA