Protein Sequence for fig|93061.5.peg.1489 from Staphylococcus aureus subsp. aureus NCTC 8325

>fig|93061.5.peg.1489 Late competence protein ComGF, access of DNA to ComEA, FIG017774
MLVAMMVISITLLIVPDLIRLSKTFLIESRDLTTVDFEFFSRDILDDFKGVDRNDIEIRQ
HRIILHKGEEMIEYKLINNKIIKVVNDRGNITMINNVTAFTANIYYKSIIKITITVKVGT
NVQTKTIYV