Protein Sequence for fig|93061.5.peg.1471 from Staphylococcus aureus subsp. aureus NCTC 8325

>fig|93061.5.peg.1471 Arginine pathway regulatory protein ArgR, repressor of arg regulon
MPKKSVRHIKIREIISNEQIETQDELVKRLNDYDLNVTQATVSRDIKELQLIKVPIPSGQ
YVYSLPNDRKFHPLEKLGRYLMDSFVNIDGTDNLLVLKTLPGNAQSIGAILDQINWEEVL
GTICGDDTCLIICRSKEASDEIKSRIFNLL