Protein Sequence for fig|93061.5.peg.1396 from Staphylococcus aureus subsp. aureus NCTC 8325

>fig|93061.5.peg.1396 Phage DNA packaging protein
MSLEEIKLWLRIDYNFENDLIEGLIQSAKSELLLSGVPDYDKDDLEYPLFCTAIKYIIAR
DYESRGYSNDQSRSKVFNEKGLQKMILKLKKW