Protein Sequence for fig|93061.5.peg.1331 from Staphylococcus aureus subsp. aureus NCTC 8325

>fig|93061.5.peg.1331 Cell division protein GpsB, coordinates the switch between cylindrical and septal cell wall synthesis by re-localization of PBP1
MSDVSLKLSAKDIYEKDFEKTMARGYRREEVDAFLDDIIADYQKMADMNNEVVKLSEENH
KLKKELEELRLRVATSRPQDNKSFSSNNTTTNTSSNNVDILKRISNLEKAVFGK