SEED Viewer version 2.0

Welcome to the SEED Viewer - a read-only browser of the curated SEED data.
For more information about The SEED please visit theSEED.org.
For daily updates on SEED activity visit the Daily SEED

»Navigate Startpage Organisms Browse Subsystems Curate Subsystems Scenarios FigFams BLAST Search Visit the Daily SEED Request a Subsystem »Back to Annotation »Help What is the SEED HowTo use the SEED Viewer Submitting Data to SEED Contact Register I forgot my Password

Protein Sequence for fig|93061.5.peg.1300 from Staphylococcus aureus subsp. aureus NCTC 8325

>fig|93061.5.peg.1300 FIG01108781: hypothetical protein
MKMTNPTRTKRCGGDVLCGIDNHFQLLLYISENHCQLETKTFFEYFLRIVNKTHDYAILE
NKKICISH