Protein Sequence for fig|93061.5.peg.1300 from Staphylococcus aureus subsp. aureus NCTC 8325

>fig|93061.5.peg.1300 FIG01108781: hypothetical protein
MKMTNPTRTKRCGGDVLCGIDNHFQLLLYISENHCQLETKTFFEYFLRIVNKTHDYAILE
NKKICISH