Protein Sequence for fig|93061.5.peg.1144 from Staphylococcus aureus subsp. aureus NCTC 8325

>fig|93061.5.peg.1144 SSU ribosomal protein S15p (S13e)
MAISQERKNEIIKEYRVHETDTGSPEVQIAVLTAEINAVNEHLRTHKKDHHSRRGLLKMV
GRRRHLLNYLRSKDIQRYRELIKSLGIRR