Protein Sequence for fig|93061.3.peg.635 from Staphylococcus aureus subsp. aureus NCTC 8325

>fig|93061.3.peg.635 hypothetical protein
MVLMLTLSFPFTTLFQITSCSIYILIFLLNSFQFINLLYHVHTVFRQFSCKKLFSGSKQI
SL