Protein Sequence for fig|904319.3.peg.1166 from Staphylococcus epidermidis VCU037

>fig|904319.3.peg.1166 putative membrane protein
MKAYLYKFMPLLIFVIGLIIFYVFNDYPTLIHVIVIIAFITNGLKNVYFVNNNIRNHMIW
VSPKLDRILGMISGILYFGIYVVGFIKQQPLWIVMLILVSTVGTAVLLETKLHITSLQLE
ETLSSERIKRKVISRHKAQRLKCIFFTVIVVVIISMLISLYLKLMVIFGLAVTIFILASI
SVAIFEKYFTIIENM