Protein Sequence for fig|665950.3.peg.1959 from Lachnospiraceae bacterium 3_1_46FAA

>fig|665950.3.peg.1959 Threonine dehydratase (EC 4.3.1.19)
MMTLEKFEEASELVKKVTNSTKLVYSDYLSEQSGGKVYLKPENMQHTGAYKIRGAYYKIS
TLSDEERGRGLITASAGNHAQGVAFAAKKFGCKAVIVMPTVTPLIKVNRTKSYGAEVILH
GDVYDDAYAYACELAEKEGYTFVHPFNDIDVATGQGTIAMEIVQELPTVDYILVPIGGGG
LVSGVATLAKMLNPKIKVIGVEPAEAASMKAALAAGEVVQLESANTIADGTAVKAVGDKI
LPFVKENVDDVLLVEDDELIGAFLDMVENHKMIVENSGLLSVAALKQLDCKGKKVVCVLS
GGNMDVITMSSIVQHGLIQRDRIFSVSVLLPDKPGELVQVAQTIAEAQGNVIKLEHNQFV
STNRNAAVELRITMEAFGTEHKQEILKALEKKGYRPRLIGAKLY