Protein Sequence for fig|658659.3.peg.1421 from Erysipelotrichaceae bacterium 3_1_53

>fig|658659.3.peg.1421 Cysteine desulfurase (EC 2.8.1.7)
MIYLDYASTTPIRPEILKTYYKLLQDYYGNSDSLHDLGRESGKLMEQSRAQIAQLLHVYR
EEILFTSCASESNNAAIKGAAWQYAGRGKHLITTCVEHSSIHNAMEQLKEYFGYEVTYLP
VNASGSVDVEALKQALRKDTILVSMMLVNNETGAINPIRACADYVHANSRALFHVDGVQA
LGKVEVDLSCVDLATFSAHKIYGLKGSAILYKKKHVELVPLISGGQQENGMRAGTSNAPV
NIVFAKTLRLALEQQKEAYAHVKALNAHLRKEVSVMEDIVINSPQDGSPFILNISNLRIG
SEIMLNALNAKGFAVSAQSTCSSHSKAVSAVLLAMGLGEQRATHAIRISLSHLTTRQEVD
AFLQALKEINHDYRTK