Protein Sequence for fig|649764.3.peg.1527 from Slackia exigua ATCC 700122

>fig|649764.3.peg.1527 Cysteine synthase (EC 2.5.1.47)
MTVYTSIDQLIGNTPLLELKGIEAKEGLKARVLGKLEYFNPAGSVKDRIAKAMLDDAEAR
GKIGPGATIIEPTSGNTGVGLASVAAARGYKVVITMPETMSVERRLLMKAYGAQLVLTDG
SKGMKGAIAKAQELADQMPNSFLAGQFVNPANPAVHKATTGPEIWADTDGTVDIFVAGVG
TGGTVTGTGAYLKEQNSAVKVVAVEPASSPVLSEGTSGSHKIQGIGAGFVPDVLDTSVYD
EVVKVENDDAFETGREIGRLEGVLVGISSGAAVWAAVELAKRPENEGKTIVALLPDTGER
YLSTPLFAE