Protein Sequence for fig|585155.3.peg.896 from Staphylococcus aureus subsp. aureus H19

>fig|585155.3.peg.896 putative esterase
MFKNDQDVERFFYKREIENRKKHKQPSTLNVKANLEKLSLDDMQVFRFNFRHQIDKKILY
IHGGFNALQPSPFHWRLLDKITLSTLYEVVLPIYPKTPEFHIDDTFQAIQRVYDQLVSEV
GHQNVVVMGDGSGGALALSFVQSLLDNQQPLPNKLYLISPILDATLSNKDISDALIEQDA
VLSQFGVNEIMKKWANGLPLTDKRISPINGTIEGLPPVYMFGGGREMTHPDMKLFEQMML
QHHQYIEFYDYPKMVHDFPIYPIRQSHKAIKQIAKSIDEDVTQNN