Protein Sequence for fig|585154.3.peg.2415 from Staphylococcus aureus subsp. aureus EMRSA16

>fig|585154.3.peg.2415 putative esterase
MFKNDQDVERFFYKREIENRKKHKQPSTLNVKANLEKLSLDDMQVFRFNFRHQIDKKILY
IHGGFNALQPSPFHWRLLDKITLSTLYEVVLPIYPKTPEFHIDDTFQAIQRVYDQLVSEV
GHQNVVVMGDGSGGALALSFVQSLLDNQQPLPNKLYLISPILDATLSNKDISDALIEQDA
VLSQFGVNEIMKKWANGLPLTDKRISPINGTIEGLPPVYMFGGGREMTHPDMKLFEQMML
QHHQYIEFYDYPKMVHDFPIYPIRQSHKAIKQIAKSIDEDVTQNN