Protein Sequence for fig|451515.3.peg.8 from Staphylococcus aureus subsp. aureus USA300_FPR3757

>fig|451515.3.peg.8 Replication initiation protein, topisomerase
MSVEPQIRLWDILQTKFKAKALQEKVYIEYDKVKADSWDRRNMRIEFNPNKLTRDEMIWL
KQNIISYMEDDGFTRLDLAFDFEDDLSDYYAMSDKAVKKTIFYGRNGKPETKYFGVRDSN
RFIRIYNKKKERKDNADAEVMSEHLWRVEIELKRDMVDYWNDCFSDLHILQPDWKTIQRT
ADRAIVFMLLSDEEEWGKLHRNSRTKYKNLIKEISPVDLTDLMKSTLKANEKQLQKQIDF
WQHEFKFWK