Protein Sequence for fig|451515.3.peg.587 from Staphylococcus aureus subsp. aureus USA300_FPR3757

>fig|451515.3.peg.587 LSU ribosomal protein L7p/L12p (P1/P2)
MANHEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAVAGAAGGADAAAEKTEFDVEL
TSAGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEALPKEEAEKLKEQLEEVGATVE
LK