Protein Sequence for fig|451515.3.peg.412 from Staphylococcus aureus subsp. aureus USA300_FPR3757

>fig|451515.3.peg.412 FIG01108269: hypothetical protein
MAFTLSAIQQAHQQFTGVDFPKLFKAFKDMGMTYNIVNIQDGTATYVHQSEDDIVTSSVK
SNHPVAQKSNKTIVQDVLTRHQQGQTDFETFCDEMAEAGIYKWHIDIQAGTCTYIDLQDQ
AVISELIPQ