Protein Sequence for fig|451515.3.peg.2774 from Staphylococcus aureus subsp. aureus USA300_FPR3757

>fig|451515.3.peg.2774 FIG01108172: hypothetical protein
MYTFDAQSLTARENYKLLIGSIIPRPIAFVTTLNQDASVNAAPFSFFNIVNNHPPMIAIA
VQRAGGKRKDTALNIERTGDFVVHITDEDNVQDINETAAPLAYGDSELSRTELSLLTSTT
IKTPGIKDAKMRFECKLSQMILLGDVLDGADLIIGEIVTYHIDDSIYEGDFKINPHALQA
VSRLAGNDYAKLGGIFTIKRPEK