Protein Sequence for fig|451515.3.peg.2648 from Staphylococcus aureus subsp. aureus USA300_FPR3757

>fig|451515.3.peg.2648 Thioredoxin
MVKQLNSVEAFREFIHQYPLAVVHVMRDQCSVCHAVLPQIEDLMQSYPNVPLAVINQSQV
EAIAGELNIFTVPVDLIFMNGKEMHRQGRFIDMQRFEHHLKQMNDSVNNDVDEH