Protein Sequence for fig|451515.3.peg.2595 from Staphylococcus aureus subsp. aureus USA300_FPR3757

>fig|451515.3.peg.2595 DNA/RNA helicase of DEAD/DEAH box family
MSRLLNDFNQSLHKGFIDKHISHKGNYTPKLLVNNKNEKVLSTIIDELQKCETFYFSVAF
ITESGLASLKAQLLDLSNKGVKGKILTSNYLGFNSPKMYGELLKLKNVEVRLTDIAGFHA
KGYIFEHKDYSSMVIGSSNLTSNALKVNYEHNVLLSTMKNGDLVDSVKSEFDLLWQKSTP
LTEQWINSYKESFEYRSLEKLAEVEQTQMLLADKVKKSVEIVPNLMQAEALRSLKAIRDK
AKDKALIISATGTGKTILCALDVREVNPNKFLFIVHNEGILNRAKEEFKKVLPIKNDSDF
GLLTGKHRDVDAKYLFATIQTLSRDDNFKQFDENEFDYIVFDEAHRSAASTYQRVFNYFK
PKFMLGMTATPERSDELSIFELFDYNIAYEIRLQAALESDILCPFHYFGVTDYVHQGIKE
DDVTKLRYLTSDERVNYIIQKTDYYGYSGEILQGLIFVSSKKEAYDLADKLSSKGIKSVA
LTGDDSVNYRQIVIEKLKEGKINYIITVDLFNEGIDIPEVNQVVMLRPTESSIIFIQQLG
RGLRKSSNKEYVTVIDFIGNYKTNYLIPIALSGDQSQNKDNYKKFLTNNDSINGVSTINF
EEVAKKQIYNSLDAVSLNQNKLILKAYEEVENRLGHMPLLMDFIQQHSIDPSVIFSKFSN
YYEFLVRYKKIDTLLTENESKNLVFFSRQIAPGLKRIDSLVLEELLKNELTYDELKNKML
NEVKDITEDDIDTSLRILDFSFYNAGIEKIYGSPIIERNERMIRLSDAFTNALSNQTFNM
FLEDLIELSKYNNEKYQKGKNGLILYNKYSREDFSKIFNWNKNGSSVIMGYMIKSQEMPI
FITYDKHEDISDSTKYEDEFLSQDELKWFTKSNRTLESKEVQKILSHRAKGIKMYIFVQK
KDDDGIYFYYLGTAGYIEGSEKQDKMPNGSNVVTMDLALDKAVRDDIYRYLTN