SEED Viewer version 2.0

Welcome to the SEED Viewer - a read-only browser of the curated SEED data.
For more information about The SEED please visit theSEED.org.
For daily updates on SEED activity visit the Daily SEED

»Navigate Startpage Organisms Browse Subsystems Curate Subsystems Scenarios FigFams BLAST Search Visit the Daily SEED Request a Subsystem »Back to Annotation »Help What is the SEED HowTo use the SEED Viewer Submitting Data to SEED Contact Register I forgot my Password

Protein Sequence for fig|451515.3.peg.2466 from Staphylococcus aureus subsp. aureus USA300_FPR3757

>fig|451515.3.peg.2466 FIG01108427: hypothetical protein
MMKLNLFINANETESYIDIHAPKMNDNVQSIINAVNDLDKSHTLVGYIDKEIHIINVSDV
ITFQVINKNVTAITSNQKFKLKLRLYELEKQLPQHFIRISKSEIVNKYYIEKLLLEPNGL
IRMYLKDAHYTYSSRRYLKSIKERLSI