Protein Sequence for fig|451515.3.peg.2466 from Staphylococcus aureus subsp. aureus USA300_FPR3757

>fig|451515.3.peg.2466 FIG01108427: hypothetical protein
MMKLNLFINANETESYIDIHAPKMNDNVQSIINAVNDLDKSHTLVGYIDKEIHIINVSDV
ITFQVINKNVTAITSNQKFKLKLRLYELEKQLPQHFIRISKSEIVNKYYIEKLLLEPNGL
IRMYLKDAHYTYSSRRYLKSIKERLSI