Protein Sequence for fig|451515.3.peg.2455 from Staphylococcus aureus subsp. aureus USA300_FPR3757

>fig|451515.3.peg.2455 Multidrug resistance protein [function not yet clear]
MKKMILINVITVVVLLAIGIAGFYFWNKTTSYVTTDNAKVNGDQIKIASPASGQIKSLNV
KQGDKLDKGDKVAIVTVQGQDGETKDMDLKMPQKGTIAKLDGMEGSMVQAGNPIAYAYNL
DDLYVTANIDEKDIKDVEVGKDVDVTIDGQKASIKGKVDSIGKATAASFSLMPSSNSDGN
YTKVSQVIPVKITLESEPSKQVVPGMNAEVKIHKN