Protein Sequence for fig|451515.3.peg.2452 from Staphylococcus aureus subsp. aureus USA300_FPR3757

>fig|451515.3.peg.2452 putative esterase
MFKNDQDVERFFYKREIENRKKHKQPSTLNVKANLEKLSLDDMQVFRFNFRHQIDKKILY
IHGGFNALQPSPFHWRLLDKITLSTLYEVVLPIYPKTPEFHIDDTFQAIQRVYDQLVSEV
GHQNVVVMGDGSGGALALSFVQSLLDNQQPLPNKLYLISPILDATLSNKDISDALIEQDA
VLSQFGVNEIMKKWANGLPLTDKRISPINGTIEGLPPVYMFGGGREMTHPDMKLFEQMML
QHHQYIEFYDYPKMVHDFPIYPIRQSHKAIKQIAKSIDEDVTQNN