Protein Sequence for fig|451515.3.peg.2373 from Staphylococcus aureus subsp. aureus USA300_FPR3757

>fig|451515.3.peg.2373 Molybdenum transport ATP-binding protein ModC (TC 3.A.1.8.1)
MLKINVKYQLKNTLIRINIDDTEPKIYAVRGPSGIGKTTVLNMIAGLRKADEAIIEVNGQ
LLTDTAKNVNVKIQQRRIGYLFQDYQLFPNMTVYKNITFMAEPSEHIDQLIQTLNIDHLM
KQYPMTLSGGEAQRVALARALSTKPDLILLDEPFSSLDDTTKDESITLVKRIFNEWQIPI
IFVTHSNYEAEQMAHEIITIG