Protein Sequence for fig|451515.3.peg.2163 from Staphylococcus aureus subsp. aureus USA300_FPR3757

>fig|451515.3.peg.2163 Serine phosphatase RsbU, regulator of sigma subunit
MEEFKQHYKGLIDESLTCQDKVELIKKCEKYTDEVIRKDVLPEDIVDIHKNYILTLNLTR
EDVFKTLDVLQEIVKGFGYSYRDYQRLVDKLQVHDKEIDLASSLQQTMLKTDIPQFDSIQ
IGVISVAAQKVSGDYFNLIDHNDGTMSFAVADVIGKGIPAALAMSMIKFGMDSYGHSQLP
SDGLKRLNRVVEKNINQNMFVTMFYGLYEEMNHLLYCSSAGHEPGYIYRAEKEEFEEISV
RGRVLGISSQTRYQQQEIPIYLDDLIIILTDGVTEARNSEGTFIDKQKLLEYIKKHKHMH
PQDIVQIIYEAILKLQNPNKKDDMTILIIKRVN