Protein Sequence for fig|451515.3.peg.1960 from Staphylococcus aureus subsp. aureus USA300_FPR3757

>fig|451515.3.peg.1960 Arginine ABC transporter, substrate-binding and permease protein
MKCLIRFILVLGLLISSAMVYINPTAHAEQDQTWEKIKERGELRVGLSADYAPMEFEHTV
NGKTEYAGVDIDLAKKIAKDNNLKLKIVNMSFDSLLGALKTGKIDIIISGMTSTPERKKQ
VDFSDSYMMTKNIMLVKKDKVNEYKDIKDFNNKKVGAQKGTEQEKIAQTEIENASITSLS
RLPDVILALKSGKVEGAVVEKPVAEAYLKQNPKLGISNVKFNEEEKDTVIAVPKDSPKLL
SQINKTIKEVKDKGLIDKYMTNAANAMNDDSGFISKYGSFFLKGIKITILISLIGVALGS
ILGAFVALMKLSKIKIISWIASIYIEILRGTPMLVQVFIVFFGITAALGLDISALVCGTI
ALVINSSAYIAEIIRAGINAVDKGQMEAARSLGLNYRQTMKSVIMPQAIKNILPALGNEF
VTLIKESSIVSTIGVGEIMFNAQVVQGISFDPFTPLIVAAALYFVLTFVLTRIMNMIEGR
LNASD