Protein Sequence for fig|451515.3.peg.1727 from Staphylococcus aureus subsp. aureus USA300_FPR3757

>fig|451515.3.peg.1727 sigmaB-controlled gene product
MADESKFDQFKGNVKETVGNVTDNKELEKEGQQDKVIGKAKEVVENAKNKITDAIDKLKK