Protein Sequence for fig|451515.3.peg.1660 from Staphylococcus aureus subsp. aureus USA300_FPR3757

>fig|451515.3.peg.1660 UPF0135 protein Bsu YqfO @ Bsu YqfO NIF3/CutA domain
MKIADLMTLLDHHVPFSTAESWDNVGLLIGDEDVEVTGVLTALDCTLEVVNEAIEKGYNT
IISHHPLIFKGVTSLKANGYGLIIRKLIQHDINLIAMHTNLDVNPYGVNMMLAKAMGLKN
ISIINNQQDVYYKVQTYIPKDNVGPFKDKLSENGLAQEGNYEYCFFESEGRGQFKPVGEA
NPTIGQIDKIEYVDEVKIEFMIDAYQKSRAEQLIKQYHPYETPVFDFIEIKQTSLYGLGV
MAEVDNQMTLEDFAADIKSKLNIPSVRFVGESNQKIKRIAIIGGSGIGYEYQAVQQGADV
FVTGDIKHHDALDAKIHGVNLIDINHYSEYVMKEGLKALLMNWFNTEKINLDVEASTINT
DPFQYI