Protein Sequence for fig|451515.3.peg.135 from Staphylococcus aureus subsp. aureus USA300_FPR3757

>fig|451515.3.peg.135 Disulfide bond regulator
MKQYGEKFIDEFSKAELEKLAKQGQLIDVRTEEEYALGHINGSILHPVDEIESFNKEKNK
TYYVICRSGNRSANASKYLAKQGYNVINLDGGYKAYEEENDSYDTQEEYKSIEIKADRKQ
FNYRGLQCPGPIVKISQEMKNIEVGDQIEVKVTDPGFPSDIKSWVKQTRHTLVKLDENNN
GINAIIQKEKAKDLDINYSAKGTTIVLFSGELDKAVAALIIANGARAAGKDVTIFFTFWG
LNALKKVQTVNVKKQGIAKMFDLMLPKKNIRMPLSKMNMFGLGNMMMRYVMKKKNVDSLP
TLINQAIEQNIKLIACTMSMDVMGIQKEELRDEVEYGGVGTYIGATENANHNLFI