Protein Sequence for fig|426430.8.peg.915 from Staphylococcus aureus subsp. aureus str. Newman

>fig|426430.8.peg.915 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase (EC 3.1.3.104)
MQPHLICLDLDGTLLNDNKEISSYTKQVLNELQQRGHQIMIATGRPYRASQMYYHELNLT
TPIVNFNGAYVHHPKDKNFKTCHEILDLGIAQNIIQGLQQYQVSNIIAEVKDYVFINNHD
PRLFEGFSMGNPRIQTGNLLVHLKESPTSILIEAEESKIPEIKNMLTHFYADHIEHRRWG
APFPVIEIVKLGINKARGIEQVRQFLNIDRNNIIAFGDEDNDIEMIEYARHGVAMENGLQ
ELKDVANNITFNNNEDGIGRYLNDFFNLNIRYYC