Protein Sequence for fig|426430.8.peg.662 from Staphylococcus aureus subsp. aureus str. Newman

>fig|426430.8.peg.662 Teichoic acid biosynthesis protein X
MRFTIIIPTCNNEATIRQLLISIESKEHYRILCIDGGSTDQTIPMIERLQRELKHISLIQ
LQNASIATCINKGLMDIKMTDPHDSDAFMVIKPTSIVLPGKLDRLTAAFKNNDNIDMVIG
QRAYNYHGEWKLKSADEFIKDNRIVTLTEQPDLLSMMSFDGKLFSAKFAELQCDETLANT
YNHAILVKAMQKATDIHLVSQMIVGDNDIDTHATSNDEDFNRYITEIMKIRQRVMEMLLL
PEQRLLYSDMVDRILFNNSLKYYMNEHPAVTHTTIQLVKDYIMSMQHSDYVSQNMFDIIN
TVEFIGENWDREIYELWRQTLIQVGINRPTYKKFLIQLKGRKFAHRTKSMLKR