Protein Sequence for fig|426430.8.peg.453 from Staphylococcus aureus subsp. aureus str. Newman

>fig|426430.8.peg.453 Tandem lipoprotein within Pathogenicity island
MKDEQKKEEQTNKTDSKEEQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGTWT
ILTGFSKSNKPGVLDDEGMVLYLNRNTKKATGYYFVNKVYDDISKNHNEKKYRVELKNNK
IVLLDNVEDKKLKQKIENFKFFSQYADFKDLKNYQDGNITTNENVPSYEAQYKMNNSDKN
VKKLREIYPITTNNSPNLKLYIDGDIKGSSVGYKKIEYKFSKDKGQETTLRDYLNFGPSE
GENVE