Protein Sequence for fig|426430.8.peg.416 from Staphylococcus aureus subsp. aureus str. Newman

>fig|426430.8.peg.416 Xanthine permease
MKNLILSVQHLLAMYAGAILVPIIVGTSLKFTPEQIAYLVTVDIFMCGVATFLQANKVTG
TGLPIVLGCTFTAVAPMILIGQTKGIDVLYGSLFLSGILVIIIAPFFSHLVKFFPPVVTG
SVVTIIGINLMPVAMNYLAGGQGAKDYGDVKNILLGLMTLIIILLLQRFTTGFIKSIAIL
IGLVLGTIGAGLLGMVDINQVNHAGWLGIPVPFRFSGFSFDVTSTLVFFIVAIVSLIEST
GVYHALSEITGKKLERKDFRKGYTAEGLAIVLGSIFNSFPYTAYSQNVGLVSLSGAKKNN
VIYGMVVLLLICGCIPKLGALANIIPLPVLGGAMIAMFGMVMAYGVSILGHIDFKNQNNL
LIIAVSVGLGTGISAVPQAFKGLGEQFAWLTQNGIVLGAISAIILNFFFNGIKYKQTEEN
VK