Protein Sequence for fig|426430.8.peg.2820 from Staphylococcus aureus subsp. aureus str. Newman

>fig|426430.8.peg.2820 Cold shock protein of CSP family
MNNGTVKWFNAEKGFGFIEQENGGDVFVHFSGIASDGYKTLEEGQKVTFEITEGQRGDQA
VNVQTV