Protein Sequence for fig|426430.8.peg.2708 from Staphylococcus aureus subsp. aureus str. Newman

>fig|426430.8.peg.2708 2-dehydropantoate 2-reductase (EC 1.1.1.169)
MLSVAIIGPGAVGTTIAYELQQSLPHTTLIGRHAKTITYYTVPHAPAQDIVVKGYEDVTN
TFDVIIIAVKTHQLDAVIPHLTHLAHEDTLIILAQNGYGQLEHISFKNVCQAVVYISGQK
KGDVVTHFRDYQLRIQDNALTRQFRDLVQDSQIDIVLEANIQQAIWYKLLVNLGINSITA
LGRQTVAIMHNPEIRTLCRQLLLDGCRVAQAEGLNFSEQTVDTIMTIYQGYPDEMGTSMY
YDIAHQQPLEVEAIQGFIYRRAREHNLDTPYLDTIYSFLRAYQQNM