Protein Sequence for fig|426430.8.peg.2622 from Staphylococcus aureus subsp. aureus str. Newman

>fig|426430.8.peg.2622 Fructose-1,6-bisphosphatase, Bacillus type (EC 3.1.3.11)
MTQITEKELKKKYLDLLSQNFDTPEKLATEIINLESILELPKGTEHFVSDLHGEYEAFQH
VLRNGSGNVRAKINDIFKERLSTKELNDLTALVYYPEDKLKLIKSDFQNCGQLNVWYITT
IEHLIELIKYCSSKYTRSKLRKALPKQYVYIIEELLYKSNEYQNKKSYYETLVNQVIELK
QADDLIIGLAYSVQRLVVDHLHVVGDIYDRGPQPDKIMDTLINYHSLDIQWGNHDVLWVG
AYAGSKVCLANLLRICARYDNLDIIEDAYGINLRPLLTLAEKYYDADNPAFKPKKRPDKH
ERLTQREESQITKIHQAIAMIQFKLEIPIIKRRPNFEMEERLVLEKVNYDTNEITVYGNT
YPLKDTCFQTVNRDNPAELLPEEEEVMNKLLLSFQQSEKLRRHMSFLMRKGSLYLPYNGN
LLIHGCIPVDENGEMESFEIDGHTYSGQELLDVFEYHVRKSFDEKENTDDLSTDLVWYLW
TGKYSSLFGKRAMTTFERYFIADKASHKEEKNPYYHLREDVNMVRKMLSDFGLNPDEGRI
INGHTPVKEINGEDPIKADGKMLVIDGGFSKAYQSTTGIAGYTLLYNSFGMQLVAHQQFN
AKEKILSEGIDELSIKRVVDKELQRKKIRDTNIGKDLQAQIDILKMLMHDRYLD