Protein Sequence for fig|426430.8.peg.2602 from Staphylococcus aureus subsp. aureus str. Newman

>fig|426430.8.peg.2602 Transcriptional regulator SarU (Staphylococcal accessory regulator U)
MDYQTFEKVNKFINVKAYIFFLTQELKQQYKLSLKELLILAYFYYKNEHSISLKEIIGDI
LYKQSDVVKNIKSLSKKGFINKSRNEADERRIFVSVTPIQRKKIACVINELDKIIKGFNK
ERDYIKYQWAPKYSKEFFILFMNIMYSKDFLKYRFNLTFLDLSILYVISSRKNEILNLKD
LFESIRFMYPQIVRSVNRLNNKGMLIKERSLADERIVLIKINKIQYNTIKSIFTDTSKIL
KPRKFFF